SPR
PDB:1Z6Z
Revision
Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:gi:4507185
Entry Clone Source:Synthetic
SGC Clone Accession:Tag:mgsshhhhhhssgrenlyfq*gh (N terminus); gs (C terminus); TEV protease cleavable at *
Host:BL21 (DE3)
Construct
Prelude:Sequence:EGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKD
Vector:p11
Growth
Medium:Antibiotics:Procedure:Starter culture in 3 ml of LB + 100 µg/mL. Terrific Broth + 100 µg/mL, with in-house autoinduction componenets. Cultures grown for 7 hours at 37 ºC and the temperature reduced to 15 ºC overnight.
Purification
ProcedureAffinity column: 1 mL His-Trap (GE/Amersham). Buffers: 50 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol, 5 mM imidazole; 50 mM Tris-HCl pH 7.5, 500 mM NaCl, 5% Glycerol, 30 mM imidazole; 50 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol, 250 mM imidazole. Procedure: AKTA Xpress Affinity/Gel Filtration
Gel filtration: SuperDex 200 16/60 HiLoad (GE/Amersham). Buffers: 10 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol. Procedure: AKTA Xpress Affinity/Gel Filtration
Extraction
Procedure50 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol, 5 mM imidazole, PMSF to 1 mM added. Cell pellet was resuspended in the above buffer then frozen, the thawed resuspension was lysed using Avestin C-5 microfluidizer, 4 passes. PEI pH 8 added to a final concentration of 0.05% and spun in a JA-17 rotor at 17,000 rpm.
Concentration:LigandMassSpec:Crystallization:Affinity column: 1 mL His-Trap (GE/Amersham). Buffers: 50 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol, 5 mM imidazole; 50 mM Tris-HCl pH 7.5, 500 mM NaCl, 5% Glycerol, 30 mM imidazole; 50 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol, 250 mM imidazole. Procedure: AKTA Xpress Affinity/Gel Filtration
Gel filtration: SuperDex 200 16/60 HiLoad (GE/Amersham). Buffers: 10 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol. Procedure: AKTA Xpress Affinity/Gel Filtration
NMR Spectroscopy:
Data Collection:
Data Processing: