Plasmodium falciparum pyrroline carboxylate reductase

Falciparum Pyrroline Carboxylate Reductase, putative

PDB:2RCY

Revision

Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:MAL13P1.284:s
Entry Clone Source:
SGC Clone Accession:MAL13P1.284:s:M1-S261:B4
Tag:mhhhhhhssgrenlyfqg
Host:Ros-Ox

Construct

Prelude:
Sequence:MENIKLGFMGLGQMGSALAHGIANANIIKKENLFYYGPSKKNTTLNYMSSNEELARHCDIIVCAVKPDIAGSVLNNIKPYLSSKLLISICGGLNIGKLEEMVGSENKIVWVMPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKDMDIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVEMVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYTVMNAVEAACEKSKAMGS
Vector:p15-mhl

Growth

Medium:TB
Antibiotics:
Procedure:MAL 13P1.284:s was expressed in E. coli BL21-(DE3)-Rosetta-Oxford cells in Terrific Broth (TB) in the presence of ampicillin/chloramphenicol (50 microg/mL and 25 microg/mL respectively). A single colony was inoculated into 10 mL of LB with of ampicillin/chloramphenicol (50 microg/mL and 25 microg/mL respectively) in a 50 mL Falcon tube and incubated with shaking at 250 rpm overnight at 37 degC. The culture was transferred into 50 mL of TB with 50 microg/mL ampicillin in a 250 mL shaking flask and incubated at 37 degC for 3 hours. Then the culture was transfered into 1.8 L of TB with 50 microg/mL kanamycin and 0.3 mL of antifoam (Sigma) in a 2 L bottle and cultured using the LEX system to an OD 600 of ~5, cooled to 15 degC, and induced with 0.5 mM isopropyl-1-thio-D-galactopyranoside (IPTG) overnight at 15 degC.

Purification

Procedure
STEP1:The cleared lysate was loaded onto a column prepacked with 10 g DE52 (Whatman) anion exchange resin (previously activated with 2.5 M NaCl and equilibrated with Binding Buffer); and subsequently onto a 3 mL Ni-NTA (Qiagen) column pre-equilibrated with Binding Buffer at approximately 1 – 1.5 mL/min. The volume of the Ni-NTA resin was pre-determined by the predicted protein yield from test expression analysis. After the lysate was loaded, the DE52 was further washed with 20 mL of Binding Buffer. The Ni-NTA column was then washed with 200 mL of Wash Buffer at 2 – 2.5 mL/min. After washing, the protein was eluted with 15 mL of Elution Buffer. EDTA was immediately added to the elution fraction to 1 mM; and TCEP was added to 5 mM after approximately 15 more minutes.

Step 2, Cutting His Tag: TEV enzyme(4 mg/ml with activity of 1 to 20) added to the protein and dialysis in 10 mM HEPES, pH 7.5, 500 mM NaCl, 5mM DTT overnight, the day after the protein passed through Ni_NTA column(2ml) and washed with Binding buffer, then was concentarted using a 15 mL Amicon Ultra centrifugal filter device (Millipore). TECEP (5mM) was added to the concentrated protein. The protein sample identity were evalulated by mass spectroscopy. The concentrated sample (20 mg/ml) was stored at 4 degC.

Extraction

Procedure
The culture was harvested by centrifugation. Pellets from 4 L of culture were resuspended to approximately 40 mL/L of cell culture in Binding Buffer with the addition of protease inhibitors (1 mM benzamidine and 1 mM phenylmethyl sulfonyl fluoride (PMSF)). Resuspended pellets stored at -80 degC were thawed overnight at 4 degC on the day before purification. Prior to mechanical lysis, each pellet from 1 L of culture was pretreated with 0.5 % CHAPS and 500 units of benzonase for 40 minutes at room temperature. Cells were mechanically lysed with a microfluidizer (Microfluidizer Processor, M-110EH) at approximately 18000 psi; and the cell lysate was centrifuged using a Beckman JA-25.50 rotor at ~75000 x g (24000 rpms) for 20 minutes at 10 degC.
Concentration:
Ligand
5mM NADP added to the protein before setting up crystallization plateMassSpec:
Crystallization:MAY56C-H725% glycerolThe protein ( 20mg/ml)was crystallized at 20 degC in 25% PEG 1500 0.2M Sodium chloride 0.1M Hepes 5% glycerol pH 7.5 using the sitting drop vapor diffusion method.
NMR Spectroscopy:
Data Collection:
Data Processing: