Human SH3 domain of LIM and SH3 domain protein 1

Target ID:

LASP1A

Aliases:

Lasp-1LASP1MLN50

Deposition Date:

Tuesday 30th June 2009

Families:

Cell-type specific expression

Related Diseases:

CancerSignalling

Structure type:

apo

Download Coordinates:

3I35

Authors:

Siponen, M.I., Roos, A.K., Arrowsmith, C.H., Berglund, H., Bountra, C.,Collins, R., Edwards, A.M.,Flodin, S., Flores, A., Graslund, S., Hammarstrom, M., Johansson, A., Johansson, I., Karlberg,T., Kotenyova, T., Kotzsch, A., Kragh Nielsen, T. Moche, M., Nyman, T., Persson, C., Sagemark, J., Schueler, H., Schutz, P., Thorsell, A.G., Tresaugues, L., Van Den Berg, S., Weigelt, J., Welin, M. Wisniewska, M., Nordlund, P.

Site:

Stockholm

3I35

tabs

Structure Details

LIM and SH3 protein 1 (LASP1) was first identified in a cDNA library from human breast cancer cells (1). The gene is expressed at a basal level in normal tissue but found to be upregulated in several cancers. It is not clear whether the gene product has a positive or negative role in tumour progression as conflicting results are reported (2). The actual function of LASP1 is not yet known but it plays an important role in regulating actin-based, cytoskeletal activities. Especially in leading edges of migrating cells (3).

The first characterisation of the gene showed that it can be divided into 2 main domains; one N-terminal LIM motif and one C-terminal src homology 3 (SH3) domain (4). LIM domains are found in a number of proteins where they aid protein-protein interactions by introducing a binding interface. The binding partner for the LASP1 LIM domain has not been identified but from the sequence DNA binding is also a possibility (3). The sequence in between the two main domains contains two short nebulin-like repeats, each comprised of 35 residues. These repeats allow LASP1 to bind to F-actin. SH3 domains are involved in protein-protein interactions where they recognise proline rich sequences. The LASP1 SH3 domain has been found to associate with the proteins palladin, prointerleukin-16, and zyxin to mention a few. Both palladin and zyxin are involved in cytoskeletal organization (5, 6).

We have determined the structure of the LASP1 SH3 domain to 1.4 Å resolution (PDB accession code 3I35). It shows a characteristic SH3 fold consisting of 56 residues arranged as two anti-parallel beta sheets. The plate like crystals belonged to the rather unusual space group P2 and contained only one molecule in the asymmetric unit.

Materials and Methods

LASP1

PDB:3I35

Revision

Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:gi|5453710
Entry Clone Source:Mammalian Gene Collection
SGC Clone Accession:LASP1A-k015
Tag:N-terminal hexahistidine tag with integrated TEV protease cleavage site: mhhhhhhssgvdlgtenlyfq*sm
Host:E.coli BL21(DE3) R3 pRARE, where R3 denotes a derivative of BL21(DE3) resistant to a strain of T1 bacteriophage (SGC Oxford) and the pRARE plasmid originating from the Rosetta strain (Novagen) supplies tRNAs for rare codons.

Construct

Prelude:
Sequence:MHHHHHHSSGVDLGTENLYFQSMAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Vector:pNIC-Bsa4

Growth

Medium:
Antibiotics:
Procedure:Cells from a glycerol stock were grown in 20 ml TB supplemented with 8 g/l glycerol, 100 µg/ml kanamycin and 34 µg/ml chloramphenicol at 30 °C overnight. The overnight culture (20 ml) was used to inoculate 1.5 l TB supplemented with 8 g/l glycerol, 50 µg/ml kanamycin and approximately 200 µl 204 Antifoam A6426 (Sigma). The culture was grown in a LEX bioreactor system (Harbinger Biotechnology) at 37 °C until OD600 reached ~2. The culture was down-tempered to 18 °C over a period of 1 hour before target expression was induced by addition of 0.5 mM IPTG. Expression was allowed to continue overnight and cells were harvested the following morning by centrifugation (4,400 x g, 10 min, 4 °C). The resulting cell pellet (16 g wet cell weight) was resuspended in lysis buffer (1.5 ml/g cell pellet), supplemented with 2000 U Benzonase (Merck) and one tablet of Complete EDTA-free protease inhibitor (Roche Applied Science). The cell suspension was stored at -80 °C.

Purification

Procedure
Columns
IMAC: Ni-charged 1 ml HiTrap Chelating HP (GE Healthcare)
Gel filtration column: HiLoad 16/60 Superdex 75 Prep Grade (GE Healthcare)

Procedure
Purification of the protein was performed as a two step process on an ÄKTAxpress system (GE Healthcare). Prior to purification, columns were equilibrated with IMAC wash1 buffer and gel filtration buffer, respectively. The filtered lysate was loaded onto two Ni-charged HiTrap Chelating columns connected in series and washed with IMAC wash1 buffer followed by IMAC wash2 buffer. Bound protein was eluted from the IMAC column with IMAC elution buffer and automatically loaded onto the gel filtration column. Fractions containing the target protein were pooled and fresh TCEP was added to a final concentration of 2 mM. The total volume of the pooled fractions was 12 ml and the concentration of the protein 1.52 mg/ml. The identity of the protein was confirmed by mass spectrometry.

Tag removal
The N-terminal histidine tag was proteolytically removed by incubating the target protein with His-tagged TEV protease in a molar ratio of 50:1 at 8 ºC overnight. The proteolytic reaction went to completion, as judged by SDS-PAGE. Target protein was purified from tag and protease by passing the reaction mixture over a Ni-charged 1 ml HisTrap HP column (GE Healthcare) pre-equilibrated with IMAC wash1 buffer. The protein was concentrated and the buffer was changed to GF buffer with 2 mM TCEP using a Vivaspin 20 centrifugal filter device with 10,000 MWCO (Sartorius). The final protein concentration was determined to 9.35 mg/ml in a volume of 0.68 ml The identity of the protein was confirmed by mass spectrometry.

Extraction

Procedure
The cell suspension was quickly thawed in water bath. Cells were disrupted by sonication (Vibra-Cell, Sonics) at 80% amplitude for 3 min effective time (pulsed 4s on, 4s off) and cell debris was removed by centrifugation (49,000 x g, 20 min, 4 ºC).
Concentration:
Ligand
MassSpec:
Crystallization:Crystals were obtained by the sitting drop vapour diffusion method in a 96-well plate. 0.1 µl protein solution (9.35 mg/ml) was mixed with 0.2 µl of well solution consisting of 1.6 M tri-sodium citrate dihydrate pH 6,5. The plate was incubated at 20 ºC. The crystals were quickly transferred to a cryo solution consisting of well solution complemented with 20% D-glucose and flash frozen in liquid nitrogen.
NMR Spectroscopy:
Data Collection:
Data Processing:Data was integrated using XDS and scaled using XSCALE. The structure was solved by molecular replacement using MOLREP with the cortactin-SH3 domain (PDB: 2D1X). The space group was P 1 2 1 with cell dimensions a= 25.35 Å b= 23.24 Å c= 44.72Å, β=92.47°. One monomer was located in the asymmetric unit. REFMAC5 was used for final refinement and Coot for model building. Data in the interval 23.24-1.40 Å resolution was used and at the end of the refinement the R values were: R=20.2% and Rfree=22.2%. Coordinates for the crystal structure were deposited in the Protein Data Bank, accession code 3I35 .

References

Tomasetto C, Regnier C, Moog-Lutz C, Mattei MG, Chenard MP, Lidereau R, Basset P, Rio MC: Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17. Genomics
1995, 28(3):367-376.
Zhang H, Chen X, Bollag WB, Bollag RJ, Sheehan DJ, Chew CS: Lasp1 gene disruption is linked to enhanced cell migration and tumor formation. Physiol Genomics. 2009, 38(3):372-85.
Grunewald TG, Butt E. The LIM and SH3 domain protein family: structural proteins or signal transducers or both? Mol Cancer. 2008 Apr 17;7:31.
Tomasetto C, Moog-Lutz C, Regnier CH, Schreiber V, Basset P, Rio MC: Lasp-1 (MLN 50) defines a new LIM protein subfamily characterized by the association of LIM and SH3 domains. FEBS Lett 1995, 373(3):245-249.
Rachlin AS, Otey CA: Identification of palladin isoforms and characterization of an isoform-specific interaction between Lasp-1 and palladin. J Cell Sci 2006, 119(6):995-1004.
Li B, Zhuang L, Trueb B: Zyxin interacts with the SH3 domains of the cytoskeletal proteins LIM-nebulette and Lasp-1. J Biol Chem 2004, 279(19):20401-20410.