CDPK6
PDB:3MSE
Revision
Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:PF11_0239
Entry Clone Source:SGC Clone Accession:PF11_0239:MAC03B-G02
Tag:mhhhhhhssgrenlyfqg
Host:E. coli BL21(DE3)-V2R-pRARE2
Construct
Prelude:Sequence:ISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNIESTFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIKKGIPREHIINKISFQEFKDYMLSTF
Vector:p15-mhl
Growth
Medium:TB
Antibiotics:Procedure:PF11_0239:G2 was expressed in E. coli BL21(DE3)-V2R-pRARE2 cells in Terrific Broth (TB) in the presence of ampicillin/chloramphenicol (50 microg/mL and 25 microg/mL respectively). A single colony was inoculated into 10 mL of LB with of ampicillin/chloramphenicol (50 microg/mL and 25 microg/mL respectively) in a 50 mL Falcon tube and incubated with shaking at 250 rpm overnight at 37 degC. The culture was transferred into 50 mL of TB with 50 microg/mL ampicillin in a 250 mL shaking flask and incubated at 37 degC for 3 hours. Then the culture was transfered into 1.8 L of TB with 50 microg/mL kanamycin and 0.3 mL of antifoam (Sigma) in a 1 L bottle and cultured using the LEX system to an OD 600 of ~5, cooled to 15 degC, and induced with 0.5 mM isopropyl-1-thio-D-galactopyranoside (IPTG) overnight at 15 degC.
Purification
ProcedureSTEP1:The cleared lysate was loaded onto a column prepacked with 10 g DE52 (Whatman) anion exchange resin (previously activated with 2.5 M NaCl and equilibrated with Binding Buffer); and subsequently onto a 3 mL Ni-NTA (Qiagen) column pre-equilibrated with Binding Buffer at approximately 1 - 1.5 mL/min. The volume of the Ni-NTA resin was pre-determined by the predicted protein yield from test expression analysis. After the lysate was loaded, the DE52 was further washed with 20 mL of Binding Buffer. The Ni-NTA column was then washed with 200 mL of Wash Buffer at 2 - 2.5 mL/min. After washing, the protein was eluted with 15 mL of Elution Buffer,and 1mMTCEP was added to protein.
STEP2: The sample was loaded onto a Sephadex S200 26/60 gel filtration column pre-equilibrated with 10 mM HEPES, pH 7.5 and 500 mM NaCl. The collected fractions corresponding to the correct eluted protein peak were concentrated using a 15 mL Amicon Ultra centrifugal filter device (Millipore). The protein sample identity were evalulated by mass spectroscopy. The concentrated sample (3 mg/ml) was stored at -80 degC.
Extraction
ProcedureThe culture was harvested by centrifugation. Pellets from 2 L of culture were resuspended to approximately 40 mL/L of cell culture in Binding Buffer with the addition of protease inhibitors (1 mM benzamidine and 1 mM phenylmethyl sulfonyl fluoride (PMSF)). Resuspended pellets stored at -80 degC were thawed overnight at 4 degC on the day before purification. Prior to mechanical lysis, each pellet from 1 L of culture was pretreated with 0.5 % CHAPS and 500 units of benzonase for 30 minutes at room temperature. Cells were mechanically lysed with a microfluidizer (Microfluidizer Processor, M-110EH) at approximately 18000 psi; or sonicator( 5minutes,10sec pulseon/off)and the cell lysate was centrifuged using a Beckman JA-25.50 rotor at ~75000 x g (24000 rpms) for 20 minutes at 10 degC.
Concentration:Ligand2mM CaCl2 , 4mM MgCl2and 1-2mM TECEP added to protein before setting up the plate
MassSpec:Crystallization:Crystallization plate: IC-MAZ2EC
buffer: 31%PEG400, 0.2M NH4SO4, 0.1M HEPES pH 7.5 at 20 degC
Cryo condition: 20%glycerol
NMR Spectroscopy:Data Collection:Data Processing: