ETV4
PDB:4CO8
Revision
Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:IMAGE:3854349
Entry Clone Source:SGC Clone Accession:ETV4A-c072
Tag:Tag TEV-cleavable N-terminal his6 tag.
Host:BL21(DE3)-R3-pRARE2
Construct
Prelude:Sequence:mhhhhhhssgvdlgtenlyfq^SMRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDN
Vector:pNIC28-Bsa4. Details [
PDF ]; Sequence [
FASTA ] or [
GenBank ].
Growth
Medium:Antibiotics:Procedure:The expression plasmid was transformed into the host strain and plated on LB-agar containing 50 µg/ml kanamycin and 34 µg/ml chloramphenicol. Several colonies were combined to inoculate a 1ml culture in TB (+ 50 µg/ml kanamycin, 34 µg/ml chloramphenicol). The culture was grown overnight, glycerol was added to 15% v/v (from a 50% stock), and the resulting glycerol stock was frozen at -80°C in 100 µl aliquots. A loopful of cells from the glycerol stock was inoculated into 10-ml of TB medium containing 50 µg/ml kanamycin and 34 µg/ml chloramphenicol and grown overnight at 37°C. 1L of TB medium (containing 50 µg/ml kanamycin) was inoculated with 10 ml of the overnight culture and grown in 2.5L UltraYield baffled flasks until OD600 of 2.0. Cells were cooled to 18°C, IPTG added to 0.1mM and growth continued at 18°C overnight. The cells were collected by centrifugation then the pellets were scraped out and transferred to 50-ml Falcon tubes and frozen at -80°C.
Purification
BuffersProcedureExtraction
BuffersProcedureCell extraction : Frozen cell pellets (approx. 200g) were thawed briefly in a bath of warm water (20 - 37°C) then transferred to ice. Three volumes (i.e. 3 ml for every gram of cells) of lysis buffer was added, and the cells were resuspended by agitating and disrupted by pulsed sonication (10sec on 20 sec off) for 15 minutes on ice. DNA was precipitated with the addition of 30ul/ml of 5% PEI and lysates were centrifuged for 1 hour at 50,000xg to remove cellular debris.
Lysis buffer: 50 mM HEPES, pH 7.5, 500 mM NaCl, 5% glycerol, 1 mM TCEP, 2x Set III protease inhibitors.
Column 1 : 3ml bed volume Ni-IDA
Solutions: Wash buffer: 50 mM HEPES, pH 7.5, 500 mM NaCl, 30 mM imidazole, 5% Glycerol, 1 mM TCEP.
Elution buffer: 50 mM HEPES, pH 7.5, 500 mM NaCl, 300 mM imidazole, 5% Glycerol, 1 mM TCEP.
Procedure: The cell extract was incubated with 5ml of Ni-IDA resin (GE Healthcare) for 1hr at 4°c with gentle agitation. The resin was pelleted by centrifugation (700g for 6 min), and the supernatant was decanted. The resin was washed initially with 10 column volumes of lysis buffer and pelleted by centrifugation. Ten column volumes of wash buffer1 were added and the resuspended resin was transferred to a gravity flow column and washed with 5 column volumes of wash buffer. Proteins were eluted by addition of 3 x 10 ml of elution buffer.
Enzymatic treatment and Column 2: The N-terminal His6-tag was cleaved by incubating the protein overnight with tobacco etch virus (TEV) protease (1:20 ratio at 4°C) whilst being dialyzed into dialysis buffer (50 mM HEPES, 500 mM NaCl, 5 % Glycerol, 1 mM TCEP) using a 3,500 MWCO snakeskin dialysis membrane.
Cleaved protein was purified by passing over a 2 ml pre-equilibriated 50% Ni-IDA bead solution. Elution was done in GF buffer supplemented with step gradients of 20 mM, 40 mM 100 mM and 300 mM imidazole, with flowthrough and fractions collected.
Column 3 : Gel filtration, Hiload 16/60 Superdex S75 prep grade, 120 ml (GE Healthcare)
GF buffer: 50 mM HEPES, pH 7.5, 500 mM NaCl, 5% Glycerol, 1 mM TCEP.
Procedure: The fractions from Ni-IDA column were concentrated to 2ml using a 3 KDa MWCO centrifugal concentrator and loaded on the gel filtration column in GF buffer at 1.2 ml/min. Eluted proteins were collected in 2-ml fractions and analyzed on SDS-PAGE.
Concentration:The cleaved purified protein was concentrated using a 3 KDa MWCO centrifugal concentrator to 15 mg/ml and stored at 4°C. The protein concentration was determined spectrophotometrically using ε280 = 25440
LigandMassSpec:Observed mass of protein was 11740.11 calculated mass was 11739.6
Crystallization:Crystallisation experiments were performed using the sitting drop vapour diffusion technique. Crystals of ETV4 grew at 20°C from conditions containing 0.8M sodium citrate tribasic, 0.1M cacodylate pH 6.2. Crystals were cryo protected in reservoir solution supplemented with 25% ethylene glycol and plunged into liquid nitrogen
NMR Spectroscopy:Data Collection:Data was collected at diamond light source beamline I03. Data were processed using XDS, and the structure was solved by molecular replacement using the model of ETV1 (PDBid 4AVP) and the program PHASER. Model building was performed with the program COOT and the model refinement was performed using REFMAC to a final Rfactor=11.6 % , Rfree =13.2 %.
Data Processing:
